Product Number |
ARP41675_T100 |
Product Page |
www.avivasysbio.com/cyp2d6-antibody-n-terminal-region-arp41675-t100.html |
Name |
CYP2D6 Antibody - N-terminal region (ARP41675_T100) |
Protein Size (# AA) |
497 amino acids |
Molecular Weight |
55kDa |
NCBI Gene Id |
1565 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cytochrome P450, family 2, subfamily D, polypeptide 6 |
Alias Symbols |
CPD6, CYP2D, CYP2DL1, CYPIID6, P450C2D, P450DB1, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, P450-DB1 |
Peptide Sequence |
Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Rowland,P., (2006) J. Biol. Chem. 281 (11), 7614-7622 |
Description of Target |
CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Protein Interactions |
CYP2D6; CYP2C9; POR; CYB5A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CYP2D6 (ARP41675_T100) antibody |
Blocking Peptide |
For anti-CYP2D6 (ARP41675_T100) antibody is Catalog # AAP41675 (Previous Catalog # AAPP24318) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CYP2D6 |
Uniprot ID |
P10635 |
Protein Name |
Cytochrome P450 2D6 |
Protein Accession # |
NP_000097 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000106 |
Tested Species Reactivity |
Human |
Gene Symbol |
CYP2D6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 91%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 100%; Sheep: 86%; Zebrafish: 92% |
Image 1 | Human Kidney
| Rabbit Anti-CYP2D6 Antibody Catalog Number: ARP41675 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 2 | Human Liver
| WB Suggested Anti-CYP2D6 Antibody Titration: 2.5ug/ml Positive Control: Human Liver |
|