C2 Antibody - N-terminal region (ARP41668_P050)

Data Sheet
 
Product Number ARP41668_P050
Product Page www.avivasysbio.com/c2-antibody-n-terminal-region-arp41668-p050.html
Name C2 Antibody - N-terminal region (ARP41668_P050)
Protein Size (# AA) 752 amino acids
Molecular Weight 81kDa
NCBI Gene Id 717
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name complement C2
Alias Symbols CO2, ARMD14
Peptide Sequence Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lee,K.Y., (2008) Invest. Ophthalmol. Vis. Sci. 49 (6), 2613-2619
Description of Target Component C2 is a serum glycoprotein that functions as part of the classical pathway of the complement system. Activated C1 cleaves C2 into C2a and C2b. The serine proteinase C2a then combines with complement factor 4b to create the C3 or C5 convertase. Deficiency of C2 has been reported to associated with certain autoimmune diseases and SNPs in this gene have been associated with altered susceptibility to age-related macular degeneration. This gene localizes within the class III region of the MHC on the short arm of chromosome 6. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described in publications but their full-length sequence has not been determined.
Protein Interactions PSMA4; MASP1; C5; C3; C4B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-C2 (ARP41668_P050) antibody
Blocking Peptide For anti-C2 (ARP41668_P050) antibody is Catalog # AAP41668 (Previous Catalog # AAPP10801)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human C2
Uniprot ID P06681
Protein Name complement C2
Protein Accession # NP_000054
Purification Affinity Purified
Nucleotide Accession # NM_000063
Tested Species Reactivity Human
Gene Symbol C2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Fetal Heart, MCF7 Cell Lysate
Host: Rabbit
Target: CO2
Positive control (+): Human Fetal Heart (HE)
Negative control (-): MCF7 Cell Lysate (N10)
Antibody concentration: 1ug/ml
Image 2
Human Heart
WB Suggested Anti-C2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com