PRODH2 Antibody - C-terminal region (ARP41621_P050)

• Product Number: ARP41621_P050
• Name: PRODH2 Antibody - C-terminal region (ARP41621_P050)
• Protein Size (# AA): 536 amino acids
• Molecular Weight: 59kDa
• NCBI Gene Id: 58510
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Proline dehydrogenase (oxidase) 2
• Alias Symbols: HYPDH, HSPOX1
• Peptide Sequence: Synthetic peptide located within the following region: LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: PRODH2 is similar to proline dehydrogenase (oxidase) 1, a mitochondrial enzyme which catalyzes the first step in proline catabolism. The function of this protein has not been determined.The protein encoded by this gene is similar to proline dehydrogenase (oxidase) 1, a mitochondrial enzyme which catalyzes the first step in proline catabolism. The function of this protein has not been determined.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-PRODH2 (ARP41621_P050) antibody is Catalog # AAP41621 (Previous Catalog # AAPS09801)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PRODH2
• Uniprot ID: Q9UF12
• Protein Name: Probable proline dehydrogenase 2
• Sample Type Confirmation:

  PRODH2 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_067055
• Purification: Affinity Purified
• Nucleotide Accession #: NM_021232
• Tested Species Reactivity: Human
• Gene Symbol: PRODH2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
• Image 1: Human MCF7 Whole Cell
  
  Host: Rabbit
  Target Name: PRODH2
  Sample Tissue: Human MCF7 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 2: Human HepG2
  
  WB Suggested Anti-PRODH2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysatePRODH2 is supported by BioGPS gene expression data to be expressed in HepG2
• Image 3: Human Intestine
  
  Rabbit Anti-PRODH2 Antibody
  Catalog Number: ARP41621
  Paraffin Embedded Tissue: Human Intestine
  Cellular Data: Epithelial cells of intestinal villas
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X