VSIG4 Antibody - N-terminal region (ARP41591_T100)

• Product Number: ARP41591_T100
• Name: VSIG4 Antibody - N-terminal region (ARP41591_T100)
• Protein Size (# AA): 399 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 11326
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: V-set and immunoglobulin domain containing 4
• Alias Symbols: CRIg, Z39IG
• Peptide Sequence: Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Otsuki,T., (2005) DNA Res. 12 (2), 117-126
• Description of Target: T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.
• Protein Interactions: PDK2; nef; APP; C3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-VSIG4 (ARP41591_T100) antibody is Catalog # AAP41591 (Previous Catalog # AAPP24275)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VSIG4
• Uniprot ID: Q9Y279
• Protein Name: V-set and immunoglobulin domain-containing protein 4
• Protein Accession #: NP_009199
• Purification: Protein A purified
• Nucleotide Accession #: NM_007268
• Tested Species Reactivity: Human
• Gene Symbol: VSIG4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 91%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 82%; Rat: 86%
• Image 1: Human Jurkat
  
  WB Suggested Anti-VSIG4 Antibody Titration: 5.0ug/ml
  Positive Control: Jurkat cell lysate