| Product Number |
ARP41529_T100 |
| Product Page |
www.avivasysbio.com/hsd17b6-antibody-n-terminal-region-arp41529-t100.html |
| Name |
HSD17B6 Antibody - N-terminal region (ARP41529_T100) |
| Protein Size (# AA) |
317 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
8630 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse) |
| Alias Symbols |
HSE, RODH, SDR9C6 |
| Peptide Sequence |
Synthetic peptide located within the following region: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Huang,X.F. (2001) Biochim. Biophys. Acta 1520 (2), 124-130 |
| Description of Target |
HSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HSD17B6 (ARP41529_T100) antibody |
| Blocking Peptide |
For anti-HSD17B6 (ARP41529_T100) antibody is Catalog # AAP41529 (Previous Catalog # AAPP24215) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B6 |
| Uniprot ID |
O14756 |
| Protein Name |
17-beta-hydroxysteroid dehydrogenase type 6 |
| Publications |
Mohler, J. L. et al. Activation of the androgen receptor by intratumoral bioconversion of androstanediol to dihydrotestosterone in prostate cancer. Cancer Res. 71, 1486-96 (2011). 21303972
Muthusamy, S. et al. Estrogen receptor beta and 17beta-hydroxysteroid dehydrogenase type 6, a growth regulatory pathway that is lost in prostate cancer. Proc. Natl. Acad. Sci. U. S. A. 108, 20090-4 (2011). 22114194 |
| Sample Type Confirmation |
HSD17B6 is strongly supported by BioGPS gene expression data to be expressed in A172 |
| Protein Accession # |
NP_003716 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_003725 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HSD17B6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100% |
| Image 1 | Human A172
 | WB Suggested Anti-HSD17B6 Antibody Titration: 1.25ug/ml
Positive Control: A172 cell lysateHSD17B6 is strongly supported by BioGPS gene expression data to be expressed in Human A172 cells |
|
| Image 2 | Human Liver
 | Rabbit Anti-HSD17B6 Antibody
Catalog Number: ARP41529
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hemopoietic
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
