Product Number |
ARP41516_T100 |
Product Page |
www.avivasysbio.com/slc22a1-antibody-n-terminal-region-arp41516-t100.html |
Name |
SLC22A1 Antibody - N-terminal region (ARP41516_T100) |
Protein Size (# AA) |
554 amino acids |
Molecular Weight |
61kDa |
NCBI Gene Id |
6580 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier family 22 (organic cation transporter), member 1 |
Description |
|
Alias Symbols |
OCT1, HOCT1, oct1_cds |
Peptide Sequence |
Synthetic peptide located within the following region: LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Bourdet,D.L., (2005) J. Pharmacol. Exp. Ther. 315 (3), 1288-1297 |
Description of Target |
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A1 contains twelve putative transmembrane domains and is a plasma integral membrane protein.Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter. |
Protein Interactions |
CERS2; POU2AF1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-SLC22A1 (ARP41516_T100) antibody |
Blocking Peptide |
For anti-SLC22A1 (ARP41516_T100) antibody is Catalog # AAP41516 (Previous Catalog # AAPP24202) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A1 |
Uniprot ID |
Q9NQD4 |
Protein Name |
Solute carrier family 22 member 1 |
Publications |
Expression of choline and acetylcholine transporters in synovial tissue and cartilage of patients with rheumatoid arthritis and osteoarthritis. Cell Tissue Res. 359, 465-477 (2015). 25418136 |
Protein Accession # |
NP_003048 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003057 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC22A1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-SLC22A1 Antibody Titration: 2.5ug/ml Positive Control: Jurkat cell lysate |
|
Image 2 | Human Intestine
| Rabbit Anti-SLC22A1 Antibody Catalog Number: ARP41516 Paraffin Embedded Tissue: Human Intestine Cellular Data: Epithelial cells of intestinal villas Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|