SLC22A1 Antibody - N-terminal region (ARP41516_T100)

Data Sheet
 
Product Number ARP41516_T100
Product Page www.avivasysbio.com/slc22a1-antibody-n-terminal-region-arp41516-t100.html
Name SLC22A1 Antibody - N-terminal region (ARP41516_T100)
Protein Size (# AA) 554 amino acids
Molecular Weight 61kDa
NCBI Gene Id 6580
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Solute carrier family 22 (organic cation transporter), member 1
Description
Alias Symbols OCT1, HOCT1, oct1_cds
Peptide Sequence Synthetic peptide located within the following region: LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bourdet,D.L., (2005) J. Pharmacol. Exp. Ther. 315 (3), 1288-1297
Description of Target Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A1 contains twelve putative transmembrane domains and is a plasma integral membrane protein.Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter.
Protein Interactions CERS2; POU2AF1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-SLC22A1 (ARP41516_T100) antibody
Blocking Peptide For anti-SLC22A1 (ARP41516_T100) antibody is Catalog # AAP41516 (Previous Catalog # AAPP24202)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A1
Uniprot ID Q9NQD4
Protein Name Solute carrier family 22 member 1
Publications

Expression of choline and acetylcholine transporters in synovial tissue and cartilage of patients with rheumatoid arthritis and osteoarthritis. Cell Tissue Res. 359, 465-477 (2015). 25418136

Protein Accession # NP_003048
Purification Protein A purified
Nucleotide Accession # NM_003057
Tested Species Reactivity Human
Gene Symbol SLC22A1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-SLC22A1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human Intestine
Rabbit Anti-SLC22A1 Antibody
Catalog Number: ARP41516
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com