PRPS2 Antibody - N-terminal region (ARP41509_T100)

Data Sheet
 
Product Number ARP41509_T100
Product Page www.avivasysbio.com/prps2-antibody-n-terminal-region-arp41509-t100.html
Name PRPS2 Antibody - N-terminal region (ARP41509_T100)
Protein Size (# AA) 318 amino acids
Molecular Weight 35kDa
NCBI Gene Id 5634
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Phosphoribosyl pyrophosphate synthetase 2
Alias Symbols PRSII
Peptide Sequence Synthetic peptide located within the following region: MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ishijima,S., (1997) Biochim. Biophys. Acta 1342 (1), 28-36
Description of Target The function remains unknown.
Protein Interactions NOTCH2NL; WDYHV1; PRPSAP1; PRPS2; PRPS1; FAM96A; SUMO2; UBC; ARMC9; GTF2I; BAG3; FN1; C18orf8; ELAVL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRPS2 (ARP41509_T100) antibody
Blocking Peptide For anti-PRPS2 (ARP41509_T100) antibody is Catalog # AAP41509 (Previous Catalog # AAPS09607)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PRPS2
Uniprot ID P11908
Protein Name Ribose-phosphate pyrophosphokinase 2
Sample Type Confirmation

PRPS2 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_002756
Purification Protein A purified
Nucleotide Accession # NM_002765
Tested Species Reactivity Human
Gene Symbol PRPS2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
Image 1
Human Jurkat
WB Suggested Anti-PRPS2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysatePRPS2 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com