GPX3 Antibody - N-terminal region (ARP41491_P050)

• Product Number: ARP41491_P050
• Name: GPX3 Antibody - N-terminal region (ARP41491_P050)
• Protein Size (# AA): 226 amino acids
• Molecular Weight: 26 kDa
• NCBI Gene Id: 2878
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glutathione peroxidase 3 (plasma)
• Description:
  View product citations for GPX3 Antibody - N-terminal region (ARP41491_P050) on CiteAb
• Alias Symbols: GPx-P, GSHPx-3, GSHPx-P
• Peptide Sequence: Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lee,O.J., (2005) Neoplasia 7 (9), 854-861
• Description of Target: GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme. GPX3 expression appears to be tissue-specific.
• Protein Interactions: UBQLN1; GPX3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-GPX3 (ARP41491_P050) antibody is Catalog # AAP41491 (Previous Catalog # AAPS09501)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPX3
• Uniprot ID: P22352
• Protein Name: Glutathione peroxidase 3
• Publications:

  Maccarrone, G. et al. Psychiatric patient stratification using biosignatures based on cerebrospinal fluid protein expression clusters. J. Psychiatr. Res. 47, 1572-80 (2013). 23962679

  Methionine supply alters mammary gland antioxidant gene networks via phosphorylation of nuclear factor erythroid 2-like 2 (NFE2L2) protein in dairy cows during the periparturient period. J Dairy Sci. 101, 8505-8512 (2018). 29908802

• Sample Type Confirmation:

  GPX3 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_002075
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002084
• Tested Species Reactivity: Human
• Gene Symbol: GPX3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 83%; Guinea Pig: 79%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%
• Image 1: Human Lung Tissue
  
  Rabbit Anti-GPX3 Antibody
  Catalog Number: ARP41491_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Membrane and cytoplasmic in alveolar type I & II cells
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
  
• Image 2:
  
  25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.