CKMT2 Antibody - N-terminal region (ARP41478_T100)

Data Sheet
 
Product Number ARP41478_T100
Product Page www.avivasysbio.com/ckmt2-antibody-n-terminal-region-arp41478-t100.html
Name CKMT2 Antibody - N-terminal region (ARP41478_T100)
Protein Size (# AA) 419 amino acids
Molecular Weight 46kDa
NCBI Gene Id 1160
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Creatine kinase, mitochondrial 2 (sarcomeric)
Alias Symbols SMTCK
Peptide Sequence Synthetic peptide located within the following region: GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Guerrero,K., Am. J. Physiol. Regul. Integr. Comp. Physiol. 289 (4), R1144-R1154
Description of Target Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase.Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis.
Protein Interactions UBC; ABHD6; TMED9; ELN; PSMD4; LRIF1; OLFML3; UNC119; CKMT2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CKMT2 (ARP41478_T100) antibody
Blocking Peptide For anti-CKMT2 (ARP41478_T100) antibody is Catalog # AAP41478 (Previous Catalog # AAPS09312)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CKMT2
Uniprot ID P17540
Protein Name Creatine kinase S-type, mitochondrial
Publications

Choudhuri, A., Maitra, U. & Evans, T. Translation initiation factor eif3h targets specific transcripts to polysomes during embryogenesis. Proc. Natl. Acad. Sci. U. S. A. 110, 9818-23 (2013). 23716667

Protein Accession # NP_001816
Purification Protein A purified
Nucleotide Accession # NM_001825
Tested Species Reactivity Human
Gene Symbol CKMT2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human Jurkat
WB Suggested Anti-CKMT2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human Skeletal muscle
Rabbit Anti-CKMT2 Antibody
Catalog Number: ARP41478
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
HepG2, A549
Host: Rabbit
Target: CKMT2
Positive control (+): HepG2 (HG)
Negative control (-): A549 (N03)
Antibody concentration: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com