Product Number |
ARP41478_T100 |
Product Page |
www.avivasysbio.com/ckmt2-antibody-n-terminal-region-arp41478-t100.html |
Name |
CKMT2 Antibody - N-terminal region (ARP41478_T100) |
Protein Size (# AA) |
419 amino acids |
Molecular Weight |
46kDa |
NCBI Gene Id |
1160 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Creatine kinase, mitochondrial 2 (sarcomeric) |
Alias Symbols |
SMTCK |
Peptide Sequence |
Synthetic peptide located within the following region: GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Guerrero,K., Am. J. Physiol. Regul. Integr. Comp. Physiol. 289 (4), R1144-R1154 |
Description of Target |
Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase.Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. |
Protein Interactions |
UBC; ABHD6; TMED9; ELN; PSMD4; LRIF1; OLFML3; UNC119; CKMT2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CKMT2 (ARP41478_T100) antibody |
Blocking Peptide |
For anti-CKMT2 (ARP41478_T100) antibody is Catalog # AAP41478 (Previous Catalog # AAPS09312) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CKMT2 |
Uniprot ID |
P17540 |
Protein Name |
Creatine kinase S-type, mitochondrial |
Publications |
Choudhuri, A., Maitra, U. & Evans, T. Translation initiation factor eif3h targets specific transcripts to polysomes during embryogenesis. Proc. Natl. Acad. Sci. U. S. A. 110, 9818-23 (2013). 23716667 |
Protein Accession # |
NP_001816 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001825 |
Tested Species Reactivity |
Human |
Gene Symbol |
CKMT2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human Jurkat
| WB Suggested Anti-CKMT2 Antibody Titration: 1.25ug/ml Positive Control: Jurkat cell lysate |
|
Image 2 | Human Skeletal muscle
| Rabbit Anti-CKMT2 Antibody Catalog Number: ARP41478 Paraffin Embedded Tissue: Human Muscle Cellular Data: Skeletal muscle cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 3 | HepG2, A549
| Host: Rabbit Target: CKMT2 Positive control (+): HepG2 (HG) Negative control (-): A549 (N03) Antibody concentration: 1ug/ml |
|