Product Number |
ARP41467_T100 |
Product Page |
www.avivasysbio.com/dpys-antibody-n-terminal-region-arp41467-t100.html |
Name |
DPYS Antibody - N-terminal region (ARP41467_T100) |
Protein Size (# AA) |
519 amino acids |
Molecular Weight |
56kDa |
NCBI Gene Id |
1807 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Dihydropyrimidinase |
Alias Symbols |
DHP, DHPase |
Peptide Sequence |
Synthetic peptide located within the following region: VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Thomas,H.R., (2008) Pharmacogenet. Genomics 18 (1), 25-35 |
Description of Target |
Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria. |
Protein Interactions |
DPYSL5; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DPYS (ARP41467_T100) antibody |
Blocking Peptide |
For anti-DPYS (ARP41467_T100) antibody is Catalog # AAP41467 (Previous Catalog # AAPS09301) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DPYS |
Uniprot ID |
Q14117 |
Protein Name |
Dihydropyrimidinase |
Protein Accession # |
NP_001376 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001385 |
Tested Species Reactivity |
Human |
Gene Symbol |
DPYS |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Image 1 | Transfected 293T
| WB Suggested Anti-DPYS Antibody Titration: 2.5ug/ml Positive Control: Transfected 293T |
|
|