DPYS Antibody - N-terminal region (ARP41467_T100)

Data Sheet
 
Product Number ARP41467_T100
Product Page www.avivasysbio.com/dpys-antibody-n-terminal-region-arp41467-t100.html
Name DPYS Antibody - N-terminal region (ARP41467_T100)
Protein Size (# AA) 519 amino acids
Molecular Weight 56kDa
NCBI Gene Id 1807
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Dihydropyrimidinase
Alias Symbols DHP, DHPase
Peptide Sequence Synthetic peptide located within the following region: VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Thomas,H.R., (2008) Pharmacogenet. Genomics 18 (1), 25-35
Description of Target Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.
Protein Interactions DPYSL5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DPYS (ARP41467_T100) antibody
Blocking Peptide For anti-DPYS (ARP41467_T100) antibody is Catalog # AAP41467 (Previous Catalog # AAPS09301)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DPYS
Uniprot ID Q14117
Protein Name Dihydropyrimidinase
Protein Accession # NP_001376
Purification Protein A purified
Nucleotide Accession # NM_001385
Tested Species Reactivity Human
Gene Symbol DPYS
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Transfected 293T
WB Suggested Anti-DPYS Antibody Titration: 2.5ug/ml
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com