| Product Number |
ARP41439_T100 |
| Product Page |
www.avivasysbio.com/slc13a3-antibody-middle-region-arp41439-t100.html |
| Name |
SLC13A3 Antibody - middle region (ARP41439_T100) |
| Protein Size (# AA) |
555 amino acids |
| Molecular Weight |
61kDa |
| NCBI Gene Id |
64849 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 |
| Alias Symbols |
NADC3, SDCT2, ARLIAK |
| Peptide Sequence |
Synthetic peptide located within the following region: GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Bai,X., (2006) J. Cell. Physiol. 206 (3), 821-830 |
| Description of Target |
Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC13A3 (ARP41439_T100) antibody |
| Blocking Peptide |
For anti-SLC13A3 (ARP41439_T100) antibody is Catalog # AAP41439 (Previous Catalog # AAPP24176) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLC13A3 |
| Uniprot ID |
Q8WWT9 |
| Protein Name |
Solute carrier family 13 member 3 |
| Protein Accession # |
NP_001011554 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001011554 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC13A3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 93%; Rat: 92%; Zebrafish: 77% |
| Image 1 | HepG2, 293T
 | Host: Rabbit
Target: SLC13A3
Positive control (+): HepG2 (HG)
Negative control (-): 293T (2T)
Antibody concentration: 2.5ug/ml |
|
| Image 2 | Human Jurkat
 | WB Suggested Anti-SLC13A3 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 3 | Human Kidney
 | Rabbit Anti-SLC13A3 Antibody
Catalog Number: ARP41439
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
