| Product Number |
ARP41431_P050 |
| Product Page |
www.avivasysbio.com/cldn18-antibody-c-terminal-region-arp41431-p050.html |
| Name |
CLDN18 Antibody - C-terminal region (ARP41431_P050) |
| Protein Size (# AA) |
261 amino acids |
| Molecular Weight |
28kDa |
| NCBI Gene Id |
51208 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Claudin 18 |
| Alias Symbols |
SFTA5, SFTPJ |
| Peptide Sequence |
Synthetic peptide located within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954 |
| Description of Target |
CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001).[supplied by OMIM]. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CLDN18 (ARP41431_P050) antibody |
| Blocking Peptide |
For anti-CLDN18 (ARP41431_P050) antibody is Catalog # AAP41431 (Previous Catalog # AAPP24169) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN18 |
| Uniprot ID |
P56856 |
| Protein Name |
Claudin-18 |
| Protein Accession # |
NP_001002026 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001002026 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CLDN18 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 79%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100% |
| Image 1 | Jurkat
 | WB Suggested Anti-CLDN18 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
| Image 2 | Jurkat
 | Host: Rabbit
Target Name: CLDN18
Sample Type: Jurkat
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 1ug/ml
Peptide Concentration: 5ug/ml
Lysate Quantity: 25ug/lane/lane
Gel Concentration: 0.12 |
|
| Image 3 |
 | Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/mL. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown. |
|
