DDC Antibody - middle region (ARP41426_P050)

Data Sheet
 
Product Number ARP41426_P050
Product Page www.avivasysbio.com/ddc-antibody-middle-region-arp41426-p050.html
Name DDC Antibody - middle region (ARP41426_P050)
Protein Size (# AA) 480 amino acids
Molecular Weight 54kDa
NCBI Gene Id 1644
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Dopa decarboxylase (aromatic L-amino acid decarboxylase)
Alias Symbols AADC
Peptide Sequence Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Giegling,I., (2008) Am. J. Med. Genet. B Neuropsychiatr. Genet. 147 (3), 308-315
Description of Target DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Protein Interactions ATF6; RELA; AR;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DDC (ARP41426_P050) antibody
Blocking Peptide For anti-DDC (ARP41426_P050) antibody is Catalog # AAP41426 (Previous Catalog # AAPP24164)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DDC
Uniprot ID P20711
Protein Name Aromatic-L-amino-acid decarboxylase
Protein Accession # NP_000781
Purification Affinity Purified
Nucleotide Accession # NM_000790
Tested Species Reactivity Human
Gene Symbol DDC
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human Spleen
WB Suggested Anti-DDC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com