Product Number |
ARP41425_T100 |
Product Page |
www.avivasysbio.com/ddc-antibody-n-terminal-region-arp41425-t100.html |
Name |
DDC Antibody - N-terminal region (ARP41425_T100) |
Protein Size (# AA) |
480 amino acids |
Molecular Weight |
53kDa |
NCBI Gene Id |
1644 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Dopa decarboxylase (aromatic L-amino acid decarboxylase) |
Description |
|
Alias Symbols |
AADC |
Peptide Sequence |
Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ma,J.Z., (2005) Hum. Mol. Genet. 14 (12), 1691-1698 |
Description of Target |
DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. |
Protein Interactions |
ATF6; RELA; AR; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DDC (ARP41425_T100) antibody |
Blocking Peptide |
For anti-DDC (ARP41425_T100) antibody is Catalog # AAP41425 (Previous Catalog # AAPP24163) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DDC |
Uniprot ID |
P20711 |
Protein Name |
Aromatic-L-amino-acid decarboxylase |
Publications |
Ts1Cje Down syndrome model mice exhibit environmental stimuli-triggered locomotor hyperactivity and sociability concurrent with increased flux through central dopamine and serotonin metabolism. Exp. Neurol. 293, 1-12 (2017). 28336394 |
Sample Type Confirmation |
DDC is supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_000781 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000790 |
Tested Species Reactivity |
Human |
Gene Symbol |
DDC |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 92%; Zebrafish: 92% |
Image 1 | Human HepG2
| WB Suggested Anti-DDC Antibody Titration: 5.0ug/ml Positive Control: HepG2 cell lysateDDC is supported by BioGPS gene expression data to be expressed in HepG2 |
|
Image 2 | Human 293T
| WB Suggested Anti-DDC Antibody Titration: 1ug/ml Positive Control: Human 293T cell lysate |
|
Image 3 | Human Kidney
| Rabbit Anti-DDC Antibody Catalog Number: ARP41425 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|