DDC Antibody - N-terminal region (ARP41425_T100)

Data Sheet
 
Product Number ARP41425_T100
Product Page www.avivasysbio.com/ddc-antibody-n-terminal-region-arp41425-t100.html
Name DDC Antibody - N-terminal region (ARP41425_T100)
Protein Size (# AA) 480 amino acids
Molecular Weight 53kDa
NCBI Gene Id 1644
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Dopa decarboxylase (aromatic L-amino acid decarboxylase)
Description
Alias Symbols AADC
Peptide Sequence Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ma,J.Z., (2005) Hum. Mol. Genet. 14 (12), 1691-1698
Description of Target DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Protein Interactions ATF6; RELA; AR;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DDC (ARP41425_T100) antibody
Blocking Peptide For anti-DDC (ARP41425_T100) antibody is Catalog # AAP41425 (Previous Catalog # AAPP24163)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DDC
Uniprot ID P20711
Protein Name Aromatic-L-amino-acid decarboxylase
Publications

Ts1Cje Down syndrome model mice exhibit environmental stimuli-triggered locomotor hyperactivity and sociability concurrent with increased flux through central dopamine and serotonin metabolism. Exp. Neurol. 293, 1-12 (2017). 28336394

Sample Type Confirmation

DDC is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_000781
Purification Protein A purified
Nucleotide Accession # NM_000790
Tested Species Reactivity Human
Gene Symbol DDC
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 92%; Zebrafish: 92%
Image 1
Human HepG2
WB Suggested Anti-DDC Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysateDDC is supported by BioGPS gene expression data to be expressed in HepG2
Image 2
Human 293T
WB Suggested Anti-DDC Antibody Titration: 1ug/ml
Positive Control: Human 293T cell lysate
Image 3
Human Kidney
Rabbit Anti-DDC Antibody
Catalog Number: ARP41425
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com