CYP2E1 Antibody - C-terminal region (ARP41424_P050)

• Product Number: ARP41424_P050
• Name: CYP2E1 Antibody - C-terminal region (ARP41424_P050)
• Protein Size (# AA): 493 amino acids
• Molecular Weight: 54kDa
• NCBI Gene Id: 1571
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cytochrome P450, family 2, subfamily E, polypeptide 1
• Alias Symbols: CPE1, CYP2E, P450-J, P450C2E
• Peptide Sequence: Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Dey,A., (2006) Arch. Biochem. Biophys. 447 (2), 155-166
• Description of Target: CYP2E1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.
• Protein Interactions: UBC; ABCA5; LAMC3; NMI; PTN; POR; MAFG; GATM; ECHS1; CYB5A; AGXT2; RPL13A; CLU; STUB1; AMFR; FANCG;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CYP2E1 (ARP41424_P050) antibody is Catalog # AAP41424 (Previous Catalog # AAPP24162)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2E1
• Uniprot ID: P05181
• Protein Name: Cytochrome P450 2E1
• Protein Accession #: NP_000764
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000773
• Tested Species Reactivity: Human
• Gene Symbol: CYP2E1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Guinea Pig: 92%; Horse: 79%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Sheep: 79%
• Image 1: Human Fetal Lung
  
  Host: Rabbit
  Target Name: CYP2E1
  Sample Tissue: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml