CA4 Antibody - C-terminal region (ARP41422_P050)

• Product Number: ARP41422_P050
• Name: CA4 Antibody - C-terminal region (ARP41422_P050)
• Protein Size (# AA): 312 amino acids
• Molecular Weight: 35 kDa
• NCBI Gene Id: 762
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Carbonic anhydrase IV
• Alias Symbols: CAIV, Car4, RP17
• Peptide Sequence: Synthetic peptide located within the following region: AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Yang,Z., (2005) Hum. Mol. Genet. 14 (2), 255-265
• Description of Target: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.
• Protein Interactions: PIH1D1; PRDX2; Htt; SLC4A4; SLC4A1; SLC4A3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-CA4 (ARP41422_P050) antibody is Catalog # AAP41422 (Previous Catalog # AAPP24160)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CA4
• Uniprot ID: P22748
• Protein Name: Carbonic anhydrase 4
• Protein Accession #: NP_000708
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000717
• Tested Species Reactivity: Human
• Gene Symbol: CA4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 83%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85%
• Image 1: Human Lung Tissue
  
  CA4 antibody - C-terminal region (ARP41422_P050)
  Catalog Number: ARP41422_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Cytoplasm and membrane of alveolar macrophages
  Primary Antibody Concentration: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 2: Human Lung
  
  WB Suggested Anti-CA4 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Lung
• Image 3: Human HT1080 Whole Cell
  
  Host: Rabbit
  Target Name: CA4
  Sample Tissue: Human HT1080 Whole Cell
  Antibody Dilution: 1ug/ml