CA4 Antibody - middle region (ARP41421_T100)

Data Sheet
 
Product Number ARP41421_T100
Product Page www.avivasysbio.com/ca4-antibody-middle-region-arp41421-t100.html
Name CA4 Antibody - middle region (ARP41421_T100)
Protein Size (# AA) 312 amino acids
Molecular Weight 34kDa
NCBI Gene Id 762
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Carbonic anhydrase IV
Alias Symbols CAIV, Car4, RP17
Peptide Sequence Synthetic peptide located within the following region: DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yang,Z., (2005) Hum. Mol. Genet. 14 (2), 255-265
Description of Target Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.
Protein Interactions PIH1D1; PRDX2; Htt; SLC4A4; SLC4A1; SLC4A3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CA4 (ARP41421_T100) antibody
Blocking Peptide For anti-CA4 (ARP41421_T100) antibody is Catalog # AAP41421 (Previous Catalog # AAPP24159)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CA4
Uniprot ID P22748
Protein Name Carbonic anhydrase 4
Protein Accession # NP_000708
Purification Protein A purified
Nucleotide Accession # NM_000717
Tested Species Reactivity Human
Gene Symbol CA4
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Lung
WB Suggested Anti-CA4 Antibody Titration: 5.0ug/ml
Positive Control: Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com