Product Number |
ARP41421_T100 |
Product Page |
www.avivasysbio.com/ca4-antibody-middle-region-arp41421-t100.html |
Name |
CA4 Antibody - middle region (ARP41421_T100) |
Protein Size (# AA) |
312 amino acids |
Molecular Weight |
34kDa |
NCBI Gene Id |
762 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Carbonic anhydrase IV |
Alias Symbols |
CAIV, Car4, RP17 |
Peptide Sequence |
Synthetic peptide located within the following region: DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Yang,Z., (2005) Hum. Mol. Genet. 14 (2), 255-265 |
Description of Target |
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport. |
Protein Interactions |
PIH1D1; PRDX2; Htt; SLC4A4; SLC4A1; SLC4A3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CA4 (ARP41421_T100) antibody |
Blocking Peptide |
For anti-CA4 (ARP41421_T100) antibody is Catalog # AAP41421 (Previous Catalog # AAPP24159) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CA4 |
Uniprot ID |
P22748 |
Protein Name |
Carbonic anhydrase 4 |
Protein Accession # |
NP_000708 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000717 |
Tested Species Reactivity |
Human |
Gene Symbol |
CA4 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Lung
| WB Suggested Anti-CA4 Antibody Titration: 5.0ug/ml Positive Control: Human Lung |
|
|