REN Antibody - C-terminal region (ARP41409_T100)

• Product Number: ARP41409_T100
• Name: REN Antibody - C-terminal region (ARP41409_T100)
• Protein Size (# AA): 406 amino acids
• Molecular Weight: 45kDa
• NCBI Gene Id: 5972
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Renin
• Description:
  View product citations for REN Antibody - C-terminal region (ARP41409_T100) on CiteAb
• Alias Symbols: RTD, HNFJ2, ADTKD4
• Peptide Sequence: Synthetic peptide located within the following region: YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lavoie,J.L., (2006) Hypertension 47 (3), 461-466
• Description of Target: Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Mutations in this gene have been shown to cause familial hyperproreninemia.Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Transcript variants that encode different protein isoforms and that arise from alternative splicing and the use of alternative promoters have been described, but their full-length nature has not been determined. Mutations in this gene have been shown to cause familial hyperproreninemia.
• Protein Interactions: AGT; ATP6AP2; KCTD15; PCSK5; RENBP; PCSK1; M6PR; CTSB;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-REN (ARP41409_T100) antibody is Catalog # AAP41409 (Previous Catalog # AAPP24147)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human REN
• Uniprot ID: P00797
• Protein Name: Renin
• Publications:

  Kumai, Y., Bernier, N. J. & Perry, S. F. Angiotensin-II promotes Na+ uptake in larval zebrafish, Danio rerio, in acidic and ion-poor water. J. Endocrinol. 220, 195-205 (2014). 24301614

  STOX1 deficiency is associated with renin-mediated gestational hypertension and placental defects. JCI Insight. NULL, NULL (2020). 33301424

• Protein Accession #: NP_000528
• Purification: Protein A purified
• Nucleotide Accession #: NM_000537
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: REN
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
• Image 1: Mouse Heart
  
  Host: Mouse
  Target Name: REN1
  Sample Tissue: Mouse Heart
  Antibody Dilution: 1ug/ml
• Image 2: Human HepG2
  
  WB Suggested Anti-REN Antibody Titration: 2.5ug/ml
  Positive Control: HepG2 cell lysate