| Product Number |
ARP41401_P050 |
| Product Page |
www.avivasysbio.com/pon1-antibody-c-terminal-region-arp41401-p050.html |
| Name |
PON1 Antibody - C-terminal region (ARP41401_P050) |
| Protein Size (# AA) |
355 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
5444 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Paraoxonase 1 |
| Alias Symbols |
ESA, PON, MVCD5 |
| Peptide Sequence |
Synthetic peptide located within the following region: ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Rosenblat,M., (2006) J. Biol. Chem. 281 (11), 7657-7665 |
| Description of Target |
PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation. |
| Protein Interactions |
CLU; SUMO4; APOA1; ALB; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PON1 (ARP41401_P050) antibody |
| Blocking Peptide |
For anti-PON1 (ARP41401_P050) antibody is Catalog # AAP41401 (Previous Catalog # AAPP24139) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PON1 |
| Uniprot ID |
P27169 |
| Protein Name |
Serum paraoxonase/arylesterase 1 |
| Protein Accession # |
NP_000437 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000446 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PON1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 93%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 92% |
| Image 1 | Human Liver
 | WB Suggested Anti-PON1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver |
|
|
