MAT1A Antibody - N-terminal region (ARP41398_T100)

• Product Number: ARP41398_T100
• Name: MAT1A Antibody - N-terminal region (ARP41398_T100)
• Protein Size (# AA): 395 amino acids
• Molecular Weight: 44 kDa
• NCBI Gene Id: 4143
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Methionine adenosyltransferase I, alpha
• Alias Symbols: MAT, SAMS, MATA1, SAMS1
• Peptide Sequence: Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954
• Description of Target: MAT1A catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.This gne encodes methionine adenosyltransferase I (alpha isoform), which catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.
• Protein Interactions: MAT1A; UBC; IST1; MVK; MAT2A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Additional Information: IHC Information: Jurkat cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
• Blocking Peptide: For anti-MAT1A (ARP41398_T100) antibody is Catalog # AAP41398 (Previous Catalog # AAPP24136)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAT1A
• Uniprot ID: Q00266
• Protein Name: S-adenosylmethionine synthase isoform type-1
• Protein Accession #: NP_000420
• Purification: Protein A purified
• Nucleotide Accession #: NM_000429
• Tested Species Reactivity: Human
• Gene Symbol: MAT1A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human Jurkat
  
  WB Suggested Anti-MAT1A Antibody
  Titration: 1.25ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human Kidney
  
  Rabbit Anti-MAT1A Antibody
  Catalog Number: ARP41398
  Paraffin Embedded Tissue: Human Kidney
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X