SLC12A1 Antibody - N-terminal region (ARP41388_P050)

• Product Number: ARP41388_P050
• Name: SLC12A1 Antibody - N-terminal region (ARP41388_P050)
• Protein Size (# AA): 430 amino acids
• Molecular Weight: 47kDa
• NCBI Gene Id: 6557
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 12 (sodium/potassium/chloride transporters), member 1
• Alias Symbols: BSC1, NKCC2
• Peptide Sequence: Synthetic peptide located within the following region: NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.
• Protein Interactions: STK39; OXSR1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-SLC12A1 (ARP41388_P050) antibody is Catalog # AAP41388 (Previous Catalog # AAPP24126)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC12A1
• Uniprot ID: Q8IUN5
• Protein Name: SLC12A1 protein EMBL AAH40138.1
• Publications:

  Kelsen, S. et al. Heme oxygenase attenuates angiotensin II-mediated superoxide production in cultured mouse thick ascending loop of Henle cells. Am. J. Physiol. Renal Physiol. 295, F1158-65 (2008). 18701634

  Polyuria-associated hydronephrosis induced by xenobiotic chemical exposure in mice. Am. J. Physiol. Renal Physiol. 311, F752-F762 (2016). 27440775

  Stec, D. E. et al. Expression of heme oxygenase-1 in thick ascending loop of henle attenuates angiotensin II-dependent hypertension. J. Am. Soc. Nephrol. 23, 834-41 (2012). 22323644

• Protein Accession #: AAH40138
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000338
• Tested Species Reactivity: Human
• Gene Symbol: SLC12A1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Kidney
  
  Rabbit Anti-SLC12A1 Antibody
  Catalog Number: ARP41388
  Paraffin Embedded Tissue: Human Kidney
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 2: Human A549
  
  Host: Rabbit
  Target Name: SLC12A1
  Sample Tissue: Human A549
  Antibody Dilution: 1.0ug/ml
• Image 3: Mouse kidney, Mouse intestine
  
  Host: Rabbit
  Target: SLC12A1
  Positive control (+): Mouse kidney (M-KI)
  Negative control (-): Mouse intestine (M-IN)
  Antibody concentration: 1ug/ml
• Image 4: Human PC-3 Whole Cell
  
  Host: Rabbit
  Target Name: SLC12A1
  Sample Tissue: Human PC-3 Whole Cell
  Antibody Dilution: 5ug/ml