GNB1L Antibody - C-terminal region (ARP41328_T100)

• Product Number: ARP41328_T100
• Name: GNB1L Antibody - C-terminal region (ARP41328_T100)
• Protein Size (# AA): 327 amino acids
• Molecular Weight: 36kDa
• Subunit: beta-like protein 1
• NCBI Gene Id: 54584
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Guanine nucleotide binding protein (G protein), beta polypeptide 1-like
• Alias Symbols: GY2, FKSG1, WDR14, WDVCF, DGCRK3
• Peptide Sequence: Synthetic peptide located within the following region: RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Collins,J.E., Genome Biol. 5 (10), R84 (2004)
• Description of Target: GNB1L is a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. Therefore, this gene may contribute to the etiology of those disorders.This gene encodes a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. The gene maps to the region on chromosome 22q11, which is deleted in DiGeorge syndrome, trisomic in derivative 22 syndrome and tetrasomic in cat-eye syndrome. Therefore, this gene may contribute to the etiology of those disorders.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GNB1L (ARP41328_T100) antibody is Catalog # AAP41328 (Previous Catalog # AAPP22683)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GNB1L
• Uniprot ID: Q9BYB4
• Protein Name: Guanine nucleotide-binding protein subunit beta-like protein 1
• Protein Accession #: NP_443730
• Purification: Protein A purified
• Nucleotide Accession #: NM_053004
• Tested Species Reactivity: Human
• Gene Symbol: GNB1L
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-GNB1L Antibody Titration: 2.5ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human Skin
  
  Rabbit Anti-GNB1L Antibody
  Catalog Number: ARP41328
  Paraffin Embedded Tissue: Human Skin
  Cellular Data: Squamous epithelial cells
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 3: Jurkat
  
  Host: Rabbit
  Target Name: GNB1L
  Sample Type: Jurkat
  Lane A: Primary Antibody
  Lane B: Primary Antibody + Blocking Peptide
  Primary Antibody Concentration: 2.5ug/mL
  Peptide Concentration: 2.0ug/mL
  Lysate Quantity: 25ug/lane
  Gel Concentration: 12%