WDR6 Antibody - C-terminal region (ARP41313_P050)

Data Sheet
 
Product Number ARP41313_P050
Product Page www.avivasysbio.com/wdr6-antibody-c-terminal-region-arp41313-p050.html
Name WDR6 Antibody - C-terminal region (ARP41313_P050)
Protein Size (# AA) 484 amino acids
Molecular Weight 53kDa
NCBI Gene Id 11180
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name WD repeat domain 6
Peptide Sequence Synthetic peptide located within the following region: TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li D, (2001) Cell Mol Life Sci. Dec;58(14):2085-97.
Description of Target WDR6 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
Protein Interactions UBC; PTPN3; EMD; IRS4; HIPK4; DYRK1B; ILK; NEDD8; GRB2; TIA1; MAP2K7; NOTCH1; BRCA1; PPIP5K2; CUL3; SIRT7; G2E3; CDC42EP4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-WDR6 (ARP41313_P050) antibody
Blocking Peptide For anti-WDR6 (ARP41313_P050) antibody is Catalog # AAP41313 (Previous Catalog # AAPP22668)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human WDR6
Uniprot ID Q6AZD6
Protein Name WDR6 protein EMBL AAH78176.1
Sample Type Confirmation

WDR6 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # AAH78176
Purification Affinity Purified
Nucleotide Accession # NM_018031
Tested Species Reactivity Human
Gene Symbol WDR6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human PANC1 Whole Cell
Host: Rabbit
Target Name: WDR6
Sample Tissue: Human PANC1 Whole Cell
Antibody Dilution: 3ug/ml
Image 2
Human Jurkat
WB Suggested Anti-WDR6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateWDR6 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 3
Human Lung
Rabbit Anti-WDR6 Antibody
Catalog Number: ARP41313
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com