| Product Number |
ARP41285_P050 |
| Product Page |
www.avivasysbio.com/nkd1-antibody-n-terminal-region-arp41285-p050.html |
| Name |
NKD1 Antibody - N-terminal region (ARP41285_P050) |
| Protein Size (# AA) |
470 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
85407 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Naked cuticle homolog 1 (Drosophila) |
| Alias Symbols |
Naked1 |
| Peptide Sequence |
Synthetic peptide located within the following region: ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yan,D., (2001) Proc. Natl. Acad. Sci. U.S.A. 98 (26), 14973-14978 |
| Description of Target |
In the mouse, Nkd is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of the Wnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) signaling pathway.[supplied by OMIM]. |
| Protein Interactions |
DVL3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NKD1 (ARP41285_P050) antibody |
| Additional Information |
IHC Information: HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-NKD1 (ARP41285_P050) antibody is Catalog # AAP41285 (Previous Catalog # AAPP12424) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NKD1 |
| Uniprot ID |
Q969G9 |
| Protein Name |
Protein naked cuticle homolog 1 |
| Protein Accession # |
NP_149110 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_033119 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NKD1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 85%; Rat: 92% |
| Image 1 | Human Lung
 | Rabbit Anti-NKD1 Antibody
Catalog Number: ARP41285
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 | Human HepG2
 | WB Suggested Anti-NKD1 Antibody
Titration: 1 ug/ml
Positive Control: HepG2 cell lysate |
|
