Product Number |
ARP41267_P050 |
Product Page |
www.avivasysbio.com/wnt16-antibody-middle-region-arp41267-p050.html |
Name |
WNT16 Antibody - middle region (ARP41267_P050) |
Protein Size (# AA) |
355 amino acids |
Molecular Weight |
40kDa |
NCBI Gene Id |
51384 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Wingless-type MMTV integration site family, member 16 |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Casagrande,G., (2006) Haematologica 91 (6), 765-771 |
Description of Target |
WNT proteins are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT16 contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen. |
Protein Interactions |
BCL6; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-WNT16 (ARP41267_P050) antibody |
Blocking Peptide |
For anti-WNT16 (ARP41267_P050) antibody is Catalog # AAP41267 (Previous Catalog # AAPP22622) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human WNT16 |
Uniprot ID |
Q9UBV4 |
Protein Name |
Protein Wnt-16 |
Protein Accession # |
NP_057171 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_016087 |
Tested Species Reactivity |
Human |
Gene Symbol |
WNT16 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 93% |
Image 1 | Human Brain
| WB Suggested Anti-WNT16 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human brain |
|
|