WNT16 Antibody - middle region (ARP41267_P050)

Data Sheet
 
Product Number ARP41267_P050
Product Page www.avivasysbio.com/wnt16-antibody-middle-region-arp41267-p050.html
Name WNT16 Antibody - middle region (ARP41267_P050)
Protein Size (# AA) 355 amino acids
Molecular Weight 40kDa
NCBI Gene Id 51384
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Wingless-type MMTV integration site family, member 16
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Casagrande,G., (2006) Haematologica 91 (6), 765-771
Description of Target WNT proteins are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT16 contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen.
Protein Interactions BCL6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-WNT16 (ARP41267_P050) antibody
Blocking Peptide For anti-WNT16 (ARP41267_P050) antibody is Catalog # AAP41267 (Previous Catalog # AAPP22622)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human WNT16
Uniprot ID Q9UBV4
Protein Name Protein Wnt-16
Protein Accession # NP_057171
Purification Affinity Purified
Nucleotide Accession # NM_016087
Tested Species Reactivity Human
Gene Symbol WNT16
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 93%
Image 1
Human Brain
WB Suggested Anti-WNT16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com