| Product Number |
ARP41254_T100 |
| Product Page |
www.avivasysbio.com/wnt2b-antibody-middle-region-arp41254-t100.html |
| Name |
WNT2B Antibody - middle region (ARP41254_T100) |
| Protein Size (# AA) |
372 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
7482 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Wingless-type MMTV integration site family, member 2B |
| Alias Symbols |
WNT13 |
| Peptide Sequence |
Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Struewing,I.T., (2006) J. Biol. Chem. 281 (11), 7282-7293 |
| Description of Target |
WNT2B is a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis. This gene produces two alternative transcript variants.This gene encodes a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis. This gene produces two alternative transcript variants. |
| Protein Interactions |
RAD21; BRCA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-WNT2B (ARP41254_T100) antibody |
| Blocking Peptide |
For anti-WNT2B (ARP41254_T100) antibody is Catalog # AAP41254 (Previous Catalog # AAPP22609) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human WNT2B |
| Uniprot ID |
Q93097 |
| Protein Accession # |
NP_004176 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_004185 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
WNT2B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Ovary, Human liver
 | Host: Rabbit
Target: WNT2B
Positive control (+): Human Ovary (OV)
Negative control (-): Human liver (LI)
Antibody concentration: 1ug/ml |
|
| Image 2 | Jurkat
 | Host: Rabbit
Target Name: WNT2B
Sample Type: Jurkat
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 1.25ug/mL
Peptide Concentration: 4.0ug/mL
Lysate Quantity: 25ug/lane
Gel Concentration: 12% |
|
| Image 3 | Human Lung
 | Rabbit Anti-WNT2B Antibody
Catalog Number: ARP41254
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 4 | Human Testis
 | Human Testis |
|
