| Product Number |
ARP41245_P050 |
| Product Page |
http://www.avivasysbio.com/anti-fzd5-antibody-c-terminal-region-arp41245-p050.html |
| Product Name |
FZD5 antibody - C-terminal region (ARP41245_P050) |
| Size |
50ug |
| Gene Symbol |
FZD5 |
| Alias Symbols |
C2orf31; DKFZp434E2135; HFZ5; MGC129692 |
| Nucleotide Accession# |
NM_003468 |
| Protein Accession# |
NP_003459 |
| Swissprot Id |
Q13467 |
| Protein Size (# AA) |
585 amino acids |
| Molecular Weight |
64kDa |
| Product Format |
Lyophilized powder |
| NCBI Gene Id |
7855 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Purification |
Affinity Purified |
| Official Gene Full Name |
Frizzled family receptor 5 |
| Description |
This is a rabbit polyclonal antibody against FZD5. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Peptide Sequence |
Synthetic peptide located within the following region: SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH |
| Key Reference |
Holmen,S.L., (2005) Biochem. Biophys. Res. Commun. 328 (2), 533-539 |
| Description of Target |
Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand. |
| Partner Proteins |
GOPC, LRP6, ROR2, WNT5A, WNT7A |
| Reconstitution and Storage |
Add 50 μl of distilled water. Final anti-FZD5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Lead Time |
Domestic: within 24 hours delivery
International: 3-5 business days |
| Blocking Peptide |
For anti-FZD5 antibody is Catalog # AAP41245 (Previous Catalog # AAPS01412) |
| Immunogen |
The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the C terminal of human FZD5 |
| Complete computational species homology data |
FZD5 antibody - C-terminal region (ARP41245_P050) |
| Tissue Tool |
Find tissues and cell lines supported to express FZD5.  |
| Reviews and Data |
Computational species homology for FZD5 antibody (ARP41245); Product Protocols: FZD5 antibody tested with Human Hepg2 Cells (ARP41245_P050) |
| Homology Short |
Human, Bovine, Rat, Mouse |
| Observed Species Reactivity |
Human, Rat, Mouse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Bovine: 92%; Rat: 92%; Mouse: 85% |
