FZD5 Antibody - C-terminal region (ARP41245_P050)

• Product Number: ARP41245_P050
• Name: FZD5 Antibody - C-terminal region (ARP41245_P050)
• Protein Size (# AA): 585 amino acids
• Molecular Weight: 65 kDa
• NCBI Gene Id: 7855
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Frizzled family receptor 5
• Alias Symbols: HFZ5, C2orf31
• Peptide Sequence: Synthetic peptide located within the following region: SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Holmen,S.L., (2005) Biochem. Biophys. Res. Commun. 328 (2), 533-539
• Description of Target: Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.
• Protein Interactions: LRP6; UBTD1; LZTFL1; ABI3BP; RGS2; RPS6KA6; GSK3B; UBC; Ror2; GOPC; WNT7A; WNT5A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-FZD5 (ARP41245_P050) antibody is Catalog # AAP41245 (Previous Catalog # AAPS01412)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FZD5
• Uniprot ID: Q13467
• Protein Name: Frizzled-5
• Sample Type Confirmation:

  FZD5 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_003459
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003468
• Tested Species Reactivity: Human
• Gene Symbol: FZD5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rabbit: 87%; Rat: 93%
• Image 1: Human HepG2
  
  WB Suggested Anti-FZD5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: HepG2 cell lysateFZD5 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells