DDX47 Antibody - N-terminal region (ARP41211_P050)

• Product Number: ARP41211_P050
• Name: DDX47 Antibody - N-terminal region (ARP41211_P050)
• Protein Size (# AA): 455 amino acids
• Molecular Weight: 50kDa
• NCBI Gene Id: 51202
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 47
• Alias Symbols: RRP3, E4-DBP, HQ0256, MSTP162
• Peptide Sequence: Synthetic peptide located within the following region: MAAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lee,J.H., (2005) Biotechnol. Lett. 27 (9), 623-628
• Description of Target: DDX47 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Protein Interactions: UBC; EED; rev; PARK2; SRPK1; MLH1; KRAS; FN1; APP; EXOSC4; CAND1; PRNP; SUMO1; HDGF; SUMO2; HDAC5; SART3; Rrp1b;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DDX47 (ARP41211_P050) antibody is Catalog # AAP41211 (Previous Catalog # AAPP22586)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDX47
• Uniprot ID: Q9H0S4
• Protein Name: Probable ATP-dependent RNA helicase DDX47
• Protein Accession #: NP_057439
• Purification: Affinity Purified
• Nucleotide Accession #: NM_016355
• Tested Species Reactivity: Human
• Gene Symbol: DDX47
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-DDX47 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate