Product Number |
ARP41198_P050 |
Product Page |
www.avivasysbio.com/dnd1-antibody-c-terminal-region-arp41198-p050.html |
Name |
DND1 Antibody - C-terminal region (ARP41198_P050) |
Protein Size (# AA) |
353 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
373863 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Dead end homolog 1 (zebrafish) |
Alias Symbols |
RBMS4 |
Peptide Sequence |
Synthetic peptide located within the following region: HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Linger,R., (2008) Genes Chromosomes Cancer 47 (3), 247-252 |
Description of Target |
DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DND1 (ARP41198_P050) antibody |
Blocking Peptide |
For anti-DND1 (ARP41198_P050) antibody is Catalog # AAP41198 (Previous Catalog # AAPP22573) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DND1 |
Uniprot ID |
Q8IYX4 |
Protein Name |
Dead end protein homolog 1 |
Sample Type Confirmation |
DND1 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_919225 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_194249 |
Tested Species Reactivity |
Human |
Gene Symbol |
DND1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-DND1 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysateDND1 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
Image 2 | Human Pineal Tissue
| Rabbit Anti-DND1 Antibody Catalog Number: ARP41198_P050 Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in pinealocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
|
|