TMED4 Antibody - N-terminal region (ARP41190_T100)

Data Sheet
 
Product Number ARP41190_T100
Product Page www.avivasysbio.com/tmed4-antibody-n-terminal-region-arp41190-t100.html
Name TMED4 Antibody - N-terminal region (ARP41190_T100)
Protein Size (# AA) 227 amino acids
Molecular Weight 25kDa
NCBI Gene Id 222068
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Transmembrane emp24 protein transport domain containing 4
Alias Symbols HNLF, ERS25, p24a3, GMP25iso, p24alpha3
Peptide Sequence Synthetic peptide located within the following region: LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Otsuki,T., (2005) DNA Res. 12 (2), 117-126
Description of Target TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.
Protein Interactions UBC; rev; IKBIP; CHCHD6; SRPRB; TMED2; SF1; PPIC; SLC25A3; KIAA0368; ELAVL1; Gorasp1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TMED4 (ARP41190_T100) antibody
Blocking Peptide For anti-TMED4 (ARP41190_T100) antibody is Catalog # AAP41190 (Previous Catalog # AAPP22565)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TMED4
Uniprot ID Q7Z7H5
Protein Name Transmembrane emp24 domain-containing protein 4
Protein Accession # NP_872353
Purification Protein A purified
Nucleotide Accession # NM_182547
Tested Species Reactivity Human
Gene Symbol TMED4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Pig, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 91%; Pig: 86%; Rabbit: 92%; Rat: 86%; Zebrafish: 90%
Image 1
Human HepG2
WB Suggested Anti-TMED4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Image 2
Human Kidney
Rabbit Anti-TMED4 Antibody
Catalog Number: ARP41190
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com