Product Number |
ARP41190_T100 |
Product Page |
www.avivasysbio.com/tmed4-antibody-n-terminal-region-arp41190-t100.html |
Name |
TMED4 Antibody - N-terminal region (ARP41190_T100) |
Protein Size (# AA) |
227 amino acids |
Molecular Weight |
25kDa |
NCBI Gene Id |
222068 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Transmembrane emp24 protein transport domain containing 4 |
Alias Symbols |
HNLF, ERS25, p24a3, GMP25iso, p24alpha3 |
Peptide Sequence |
Synthetic peptide located within the following region: LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Otsuki,T., (2005) DNA Res. 12 (2), 117-126 |
Description of Target |
TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown. |
Protein Interactions |
UBC; rev; IKBIP; CHCHD6; SRPRB; TMED2; SF1; PPIC; SLC25A3; KIAA0368; ELAVL1; Gorasp1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TMED4 (ARP41190_T100) antibody |
Blocking Peptide |
For anti-TMED4 (ARP41190_T100) antibody is Catalog # AAP41190 (Previous Catalog # AAPP22565) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TMED4 |
Uniprot ID |
Q7Z7H5 |
Protein Name |
Transmembrane emp24 domain-containing protein 4 |
Protein Accession # |
NP_872353 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_182547 |
Tested Species Reactivity |
Human |
Gene Symbol |
TMED4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Pig, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 91%; Pig: 86%; Rabbit: 92%; Rat: 86%; Zebrafish: 90% |
Image 1 | Human HepG2
| WB Suggested Anti-TMED4 Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: HepG2 cell lysate |
|
Image 2 | Human Kidney
| Rabbit Anti-TMED4 Antibody Catalog Number: ARP41190 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|