Product Number |
ARP41187_T100 |
Product Page |
www.avivasysbio.com/cpeb2-antibody-middle-region-arp41187-t100.html |
Name |
CPEB2 Antibody - middle region (ARP41187_T100) |
Protein Size (# AA) |
339 amino acids |
Molecular Weight |
37kDa |
NCBI Gene Id |
132864 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cytoplasmic polyadenylation element binding protein 2 |
Alias Symbols |
CPEB-2, CPE-BP2, hCPEB-2 |
Peptide Sequence |
Synthetic peptide located within the following region: DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kurihara Y. (2003) Biol Reprod. 69(1):261-8. Epub 2003 Apr 2. |
Description of Target |
CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CPEB2 (ARP41187_T100) antibody |
Blocking Peptide |
For anti-CPEB2 (ARP41187_T100) antibody is Catalog # AAP41187 (Previous Catalog # AAPP22562) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CPEB2 |
Uniprot ID |
Q7Z5Q1 |
Protein Accession # |
XP_949637 |
Purification |
Protein A purified |
Nucleotide Accession # |
XM_944544 |
Tested Species Reactivity |
Human |
Gene Symbol |
CPEB2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-CPEB2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
|