CPEB2 Antibody - middle region (ARP41187_T100)

Data Sheet
 
Product Number ARP41187_T100
Product Page www.avivasysbio.com/cpeb2-antibody-middle-region-arp41187-t100.html
Name CPEB2 Antibody - middle region (ARP41187_T100)
Protein Size (# AA) 339 amino acids
Molecular Weight 37kDa
NCBI Gene Id 132864
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cytoplasmic polyadenylation element binding protein 2
Alias Symbols CPEB-2, CPE-BP2, hCPEB-2
Peptide Sequence Synthetic peptide located within the following region: DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kurihara Y. (2003) Biol Reprod. 69(1):261-8. Epub 2003 Apr 2.
Description of Target CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CPEB2 (ARP41187_T100) antibody
Blocking Peptide For anti-CPEB2 (ARP41187_T100) antibody is Catalog # AAP41187 (Previous Catalog # AAPP22562)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CPEB2
Uniprot ID Q7Z5Q1
Protein Accession # XP_949637
Purification Protein A purified
Nucleotide Accession # XM_944544
Tested Species Reactivity Human
Gene Symbol CPEB2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-CPEB2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com