| Product Number |
ARP41186_P050 |
| Product Page |
www.avivasysbio.com/cpeb2-antibody-n-terminal-region-arp41186-p050.html |
| Name |
CPEB2 Antibody - N-terminal region (ARP41186_P050) |
| Protein Size (# AA) |
589 amino acids |
| Molecular Weight |
65kDa |
| NCBI Gene Id |
132864 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cytoplasmic polyadenylation element binding protein 2 |
| Description |
|
| Alias Symbols |
CPEB-2, CPE-BP2, hCPEB-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kurihara,Y., (2003) Biol. Reprod. 69 (1), 261-268 |
| Description of Target |
CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.The protein encoded by this gene is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CPEB2 (ARP41186_P050) antibody |
| Blocking Peptide |
For anti-CPEB2 (ARP41186_P050) antibody is Catalog # AAP41186 (Previous Catalog # AAPP22561) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CPEB2 |
| Uniprot ID |
Q7Z5Q1-2 |
| Protein Name |
Cytoplasmic polyadenylation element-binding protein 2 |
| Publications |
CPEB2 Is Necessary for Proper Porcine Meiotic Maturation and Embryonic Development. Int J Mol Sci. 19, (2018). 30322039 |
| Protein Accession # |
NP_872291 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_182485 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CPEB2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-CPEB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
