| Product Number |
ARP41185_P050 |
| Product Page |
www.avivasysbio.com/cpeb2-antibody-middle-region-arp41185-p050.html |
| Name |
CPEB2 Antibody - middle region (ARP41185_P050) |
| Protein Size (# AA) |
589 amino acids |
| Molecular Weight |
65kDa |
| NCBI Gene Id |
132864 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cytoplasmic polyadenylation element binding protein 2 |
| Alias Symbols |
CPEB-2, CPE-BP2, hCPEB-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: SNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kurihara Y, (2003) Biol Reprod. 2003 Jul;69(1):261-8. |
| Description of Target |
CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CPEB2 (ARP41185_P050) antibody |
| Blocking Peptide |
For anti-CPEB2 (ARP41185_P050) antibody is Catalog # AAP41185 (Previous Catalog # AAPS01302) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CPEB2 |
| Uniprot ID |
Q7Z5Q1 |
| Protein Name |
Cytoplasmic polyadenylation element-binding protein 2 |
| Protein Accession # |
XP_945422 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_940329 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CPEB2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Ovary Tumor
 | Host: Rabbit
Target Name: CPEB2
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1.0ug/ml |
|
|
