Product Number |
ARP41159_P050 |
Product Page |
www.avivasysbio.com/sla-antibody-n-terminal-region-arp41159-p050.html |
Name |
SLA Antibody - N-terminal region (ARP41159_P050) |
Protein Size (# AA) |
441 amino acids |
Molecular Weight |
56 kDa |
NCBI Gene Id |
51091 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase |
Alias Symbols |
LP, SLA, PCH2D, SLA/LP |
Peptide Sequence |
Synthetic peptide located within the following region: MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Xu,X.M., (2005) J. Biol. Chem. 280 (50), 41568-41575 |
Description of Target |
SLA/LP converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis. |
Protein Interactions |
SOX2; gag; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-SEPSECS (ARP41159_P050) antibody |
Blocking Peptide |
For anti-SEPSECS (ARP41159_P050) antibody is Catalog # AAP41159 (Previous Catalog # AAPS01301) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLA/LP |
Uniprot ID |
A1A4F3 |
Protein Name |
Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA synthase EMBL AAI26214.1 |
Protein Accession # |
NP_722547 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_153825 |
Tested Species Reactivity |
Human |
Gene Symbol |
SEPSECS |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human kidney
| Rabbit Anti-SLA/LP Antibody Catalog Number: ARP41159 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
| Image 2 | Human Jurkat
| WB Suggested Anti-SLA Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate |
|
|