SLA Antibody - N-terminal region (ARP41159_P050)

Data Sheet
 
Product Number ARP41159_P050
Product Page www.avivasysbio.com/sla-antibody-n-terminal-region-arp41159-p050.html
Name SLA Antibody - N-terminal region (ARP41159_P050)
Protein Size (# AA) 441 amino acids
Molecular Weight 56 kDa
NCBI Gene Id 51091
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase
Alias Symbols LP, SLA, PCH2D, SLA/LP
Peptide Sequence Synthetic peptide located within the following region: MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Xu,X.M., (2005) J. Biol. Chem. 280 (50), 41568-41575
Description of Target SLA/LP converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.
Protein Interactions SOX2; gag;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-SEPSECS (ARP41159_P050) antibody
Blocking Peptide For anti-SEPSECS (ARP41159_P050) antibody is Catalog # AAP41159 (Previous Catalog # AAPS01301)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLA/LP
Uniprot ID A1A4F3
Protein Name Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA synthase EMBL AAI26214.1
Protein Accession # NP_722547
Purification Affinity Purified
Nucleotide Accession # NM_153825
Tested Species Reactivity Human
Gene Symbol SEPSECS
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human kidney
Rabbit Anti-SLA/LP Antibody
Catalog Number: ARP41159
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Jurkat
WB Suggested Anti-SLA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com