Product Number |
ARP41158_T100 |
Product Page |
www.avivasysbio.com/thex1-antibody-c-terminal-region-arp41158-t100.html |
Name |
THEX1 Antibody - C-terminal region (ARP41158_T100) |
Protein Size (# AA) |
349 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
90459 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Exoribonuclease 1 |
Alias Symbols |
HEXO, THEX1, 3'HEXO |
Peptide Sequence |
Synthetic peptide located within the following region: GSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Cheng,Y. (2004) J. Mol. Biol. 343 (2), 305-312 |
Description of Target |
THEX1 contains 1 SAP domain and 1 exonuclease domain. It is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). |
Protein Interactions |
UBC; HNRNPD; HHV8GK18_gp81; SLBP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ERI1 (ARP41158_T100) antibody |
Blocking Peptide |
For anti-ERI1 (ARP41158_T100) antibody is Catalog # AAP41158 (Previous Catalog # AAPP22533) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human THEX1 |
Uniprot ID |
Q8IV48 |
Protein Name |
3'-5' exoribonuclease 1 |
Protein Accession # |
NP_699163 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_153332 |
Tested Species Reactivity |
Human |
Gene Symbol |
ERI1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human HepG2
| WB Suggested Anti-THEX1 Antibody Titration: 2.5ug/ml ELISA Titer: 1:1562500 Positive Control: HepG2 cell lysate |
|
|