DRB1 Antibody - N-terminal region (ARP41153_T100)

Data Sheet
 
Product Number ARP41153_T100
Product Page www.avivasysbio.com/drb1-antibody-n-terminal-region-arp41153-t100.html
Name DRB1 Antibody - N-terminal region (ARP41153_T100)
Protein Size (# AA) 328 amino acids
Molecular Weight 36kDa
NCBI Gene Id 129831
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name RNA binding motif protein 45
Alias Symbols DRB1, RB-1
Peptide Sequence Synthetic peptide located within the following region: MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tamada,H., (2002) Biochem. Biophys. Res. Commun. 297 (1), 96-104
Description of Target DRB1 is RNA-binding protein with binding specificity for poly(C) and may play an important role in neural development.
Protein Interactions RBM45; FANCL; MEMO1; TXN2; TRAF1; TARDBP; CAND1; CUL3; UBC; USP21; KEAP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RBM45 (ARP41153_T100) antibody
Blocking Peptide For anti-RBM45 (ARP41153_T100) antibody is Catalog # AAP41153 (Previous Catalog # AAPP22528)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DRB1
Uniprot ID Q8IUH3-3
Protein Name RNA-binding protein 45
Protein Accession # NP_694453
Purification Protein A purified
Nucleotide Accession # NM_152945
Tested Species Reactivity Human
Gene Symbol RBM45
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-DRB1 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com