Product Number |
ARP41153_T100 |
Product Page |
www.avivasysbio.com/drb1-antibody-n-terminal-region-arp41153-t100.html |
Name |
DRB1 Antibody - N-terminal region (ARP41153_T100) |
Protein Size (# AA) |
328 amino acids |
Molecular Weight |
36kDa |
NCBI Gene Id |
129831 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
RNA binding motif protein 45 |
Alias Symbols |
DRB1, RB-1 |
Peptide Sequence |
Synthetic peptide located within the following region: MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Tamada,H., (2002) Biochem. Biophys. Res. Commun. 297 (1), 96-104 |
Description of Target |
DRB1 is RNA-binding protein with binding specificity for poly(C) and may play an important role in neural development. |
Protein Interactions |
RBM45; FANCL; MEMO1; TXN2; TRAF1; TARDBP; CAND1; CUL3; UBC; USP21; KEAP1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RBM45 (ARP41153_T100) antibody |
Blocking Peptide |
For anti-RBM45 (ARP41153_T100) antibody is Catalog # AAP41153 (Previous Catalog # AAPP22528) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DRB1 |
Uniprot ID |
Q8IUH3-3 |
Protein Name |
RNA-binding protein 45 |
Protein Accession # |
NP_694453 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_152945 |
Tested Species Reactivity |
Human |
Gene Symbol |
RBM45 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-DRB1 Antibody Titration: 1.25ug/ml Positive Control: HepG2 cell lysate |
|
|