APOBEC3D Antibody - N-terminal region (ARP41147_P050)

• Product Number: ARP41147_P050
• Name: APOBEC3D Antibody - N-terminal region (ARP41147_P050)
• Protein Size (# AA): 386 amino acids
• Molecular Weight: 47 kDa
• NCBI Gene Id: 140564
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D
• Alias Symbols: A3D, A3DE, ARP6, APOBEC3E, APOBEC3DE
• Peptide Sequence: Synthetic peptide located within the following region: SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Harris,R.S. (2004) Nat. Rev. Immunol. 4 (11), 868-877
• Description of Target: This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.
• Protein Interactions: FN1; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-APOBEC3D (ARP41147_P050) antibody is Catalog # AAP41147 (Previous Catalog # AAPP22522)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3D
• Uniprot ID: Q96AK3
• Protein Name: Probable DNA dC->dU-editing enzyme APOBEC-3D
• Protein Accession #: NP_689639
• Purification: Affinity Purified
• Nucleotide Accession #: NM_152426
• Tested Species Reactivity: Human
• Gene Symbol: APOBEC3D
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human kidney
  
  Rabbit Anti-APOBEC3D Antibody
  Catalog Number: ARP41147
  Paraffin Embedded Tissue: Human Kidney
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X