MGC42174 Antibody - N-terminal region (ARP41146_T100)

Data Sheet
 
Product Number ARP41146_T100
Product Page www.avivasysbio.com/mgc42174-antibody-n-terminal-region-arp41146-t100.html
Name MGC42174 Antibody - N-terminal region (ARP41146_T100)
Protein Size (# AA) 619 amino acids
Molecular Weight 68kDa
NCBI Gene Id 129563
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name DIS3 mitotic control homolog (S. cerevisiae)-like 2
Alias Symbols FAM6A, PRLMNS, hDIS3L2
Peptide Sequence Synthetic peptide located within the following region: MSHPDYRMNLRPLGTPRGVSAVAGPHDIGASPGDKKSKNRSTRGKKKSIF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Description of Target The function remains unknown.
Protein Interactions RELA; UBC; BMI1; CBX2; CBX4; COPS6; FEZ1; VIM;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DIS3L2 (ARP41146_T100) antibody
Blocking Peptide For anti-DIS3L2 (ARP41146_T100) antibody is Catalog # AAP41146 (Previous Catalog # AAPS01212)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MGC42174
Uniprot ID Q8IYB7
Protein Name DIS3-like exonuclease 2
Protein Accession # NP_689596
Purification Protein A purified
Nucleotide Accession # NM_152383
Tested Species Reactivity Human
Gene Symbol DIS3L2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Image 1
Human Intestine
Rabbit Anti-MGC42174 Antibody
Catalog Number: ARP41146
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Muscle
WB Suggested Anti-MGC42174 Antibody Titration: 1.25ug/ml
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com