MGC42174 Antibody - N-terminal region (ARP41145_T100)

Data Sheet
 
Product Number ARP41145_T100
Product Page www.avivasysbio.com/mgc42174-antibody-n-terminal-region-arp41145-t100.html
Name MGC42174 Antibody - N-terminal region (ARP41145_T100)
Protein Size (# AA) 619 amino acids
Molecular Weight 68kDa
NCBI Gene Id 129563
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name DIS3 mitotic control homolog (S. cerevisiae)-like 2
Alias Symbols FAM6A, PRLMNS, hDIS3L2
Peptide Sequence Synthetic peptide located within the following region: WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Description of Target The function remains unknown.
Protein Interactions RELA; UBC; BMI1; CBX2; CBX4; COPS6; FEZ1; VIM;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DIS3L2 (ARP41145_T100) antibody
Blocking Peptide For anti-DIS3L2 (ARP41145_T100) antibody is Catalog # AAP41145 (Previous Catalog # AAPP22521)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MGC42174
Uniprot ID Q8IYB7
Protein Name DIS3-like exonuclease 2
Protein Accession # NP_689596
Purification Protein A purified
Nucleotide Accession # NM_152383
Tested Species Reactivity Human
Gene Symbol DIS3L2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 79%; Rat: 86%
Image 1
Human Heart
Rabbit Anti-MGC42174 Antibody
Catalog Number: ARP41145
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Jurkat
WB Suggested Anti-MGC42174 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com