RG9MTD2 Antibody - middle region (ARP41144_T100)

• Product Number: ARP41144_T100
• Name: RG9MTD2 Antibody - middle region (ARP41144_T100)
• Protein Size (# AA): 339 amino acids
• Molecular Weight: 37kDa
• NCBI Gene Id: 93587
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: RNA (guanine-9-) methyltransferase domain containing 2
• Alias Symbols: MSSGM, TRM10, MSSGM1, RG9MTD2, HEL-S-88
• Peptide Sequence: Synthetic peptide located within the following region: EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Unpublished
• Description of Target: The function remains unknown.
• Protein Interactions: PPP2R5E; CALU; ARPC5L; AARSD1; ARPC3; SAE1; SH3GL1; PRKACA; ARPC1A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TRMT10A (ARP41144_T100) antibody is Catalog # AAP41144 (Previous Catalog # AAPS01211)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RG9MTD2
• Uniprot ID: Q8TBZ6
• Protein Name: tRNA methyltransferase 10 homolog A
• Protein Accession #: NP_689505
• Purification: Protein A purified
• Nucleotide Accession #: NM_152292
• Tested Species Reactivity: Human
• Gene Symbol: TRMT10A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 93%; Rat: 93%
• Image 1: Human HepG2
  
  WB Suggested Anti-RG9MTD2 Antibody Titration: 2.5ug/ml
  Positive Control: HepG2 cell lysate