APOBEC3F Antibody - C-terminal region (ARP41136_P050)

• Product Number: ARP41136_P050
• Name: APOBEC3F Antibody - C-terminal region (ARP41136_P050)
• Protein Size (# AA): 373 amino acids
• Molecular Weight: 45kDa
• NCBI Gene Id: 200316
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F
• Alias Symbols: A3F, KA6, ARP8, BK150C2.4.MRNA
• Peptide Sequence: Synthetic peptide located within the following region: ASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Volpe,F., (2008) J. Virol. 82 (11), 5636-5642
• Description of Target: APOBEC3F is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Protein Interactions: vif; BMI1; ACD; TINF2; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-APOBEC3F (ARP41136_P050) antibody is Catalog # AAP41136 (Previous Catalog # AAPP22516)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human APOBEC3F
• Uniprot ID: Q8IUX4
• Protein Name: DNA dC->dU-editing enzyme APOBEC-3F
• Protein Accession #: NP_660341
• Purification: Affinity Purified
• Nucleotide Accession #: NM_145298
• Tested Species Reactivity: Human
• Gene Symbol: APOBEC3F
• Predicted Species Reactivity: Human, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 100%
• Image 1: Human Brain
  
  WB Suggested Anti-APOBEC3F Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human brain