| Product Number |
ARP41134_P050 |
| Product Page |
www.avivasysbio.com/mgc27016-antibody-n-terminal-region-arp41134-p050.html |
| Name |
MGC27016 Antibody - N-terminal region (ARP41134_P050) |
| Protein Size (# AA) |
533 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
166863 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RNA binding motif protein 46 |
| Alias Symbols |
CT68 |
| Peptide Sequence |
Synthetic peptide located within the following region: LNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
The function remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RBM46 (ARP41134_P050) antibody |
| Blocking Peptide |
For anti-RBM46 (ARP41134_P050) antibody is Catalog # AAP41134 (Previous Catalog # AAPP22515) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MGC27016 |
| Uniprot ID |
Q8TBY0 |
| Protein Name |
Probable RNA-binding protein 46 |
| Protein Accession # |
NP_659416 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_144979 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RBM46 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
| Image 1 | Human Kidney
 | Rabbit Anti-MGC27016 Antibody
Catalog Number: ARP41134
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
| | Image 2 | Human Jurkat
 | WB Suggested Anti-MGC27016 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
|
