| Product Number |
ARP41112_T100 |
| Product Page |
www.avivasysbio.com/msi2-antibody-n-terminal-region-arp41112-t100.html |
| Name |
MSI2 Antibody - N-terminal region (ARP41112_T100) |
| Protein Size (# AA) |
328 amino acids |
| Molecular Weight |
35 kDa |
| NCBI Gene Id |
124540 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Musashi homolog 2 (Drosophila) |
| Alias Symbols |
MSI2H |
| Peptide Sequence |
Synthetic peptide located within the following region: LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Barbouti,A., (2003) Cancer Res. 63 (6), 1202-1206 |
| Description of Target |
MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Protein Interactions |
MEOX2; HNRNPH2; SUMO2; RPA3; RPA2; RPA1; SUZ12; RNF2; BMI1; TARDBP; SOX2; VCAM1; UBC; CUL3; H2AFX; GRB2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-MSI2 (ARP41112_T100) antibody |
| Blocking Peptide |
For anti-MSI2 (ARP41112_T100) antibody is Catalog # AAP41112 (Previous Catalog # AAPP22480) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MSI2 |
| Uniprot ID |
Q96DH6 |
| Protein Name |
RNA-binding protein Musashi homolog 2 |
| Protein Accession # |
NP_620412 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_138962 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MSI2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Liver
 | Rabbit Anti-MSI2 Antibody
Catalog Number: ARP41112
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocytes
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 | Human Heart
 | Rabbit Anti-MSI2 Antibody
Catalog Number: ARP41112
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 3 | HepG2
 | Host: Rabbit
Target Name: MSI2
Sample Type: HepG2
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 2.5ug/mL
Peptide Concentration: 2.0ug/mL
Lysate Quantity: 25ug/lane
Gel Concentration: 12% |
|
| Image 4 | Hela, Human lung
 | Host: Rabbit
Target: MSI2
Positive control (+): Hela (HL)
Negative control (-): Human lung (LU)
Antibody concentration: 2ug/ml |
|
