| Product Number |
ARP41107_T100 |
| Product Page |
www.avivasysbio.com/alkbh8-antibody-n-terminal-region-arp41107-t100.html |
| Name |
ALKBH8 Antibody - N-terminal region (ARP41107_T100) |
| Protein Size (# AA) |
238 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
91801 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
AlkB, alkylation repair homolog 8 (E. coli) |
| Alias Symbols |
ABH8, TRM9, MRT71, TRMT9, TRMT9A |
| Peptide Sequence |
Synthetic peptide located within the following region: EEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
The function remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ALKBH8 (ARP41107_T100) antibody |
| Blocking Peptide |
For anti-ALKBH8 (ARP41107_T100) antibody is Catalog # AAP41107 (Previous Catalog # AAPS01905) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ALKBH8 |
| Uniprot ID |
Q96BT7 |
| Protein Name |
Alkylated DNA repair protein alkB homolog 8 |
| Protein Accession # |
NP_620130 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_138775 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ALKBH8 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 79%; Rat: 86% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ALKBH8 Antibody Titration: 1.0ug/ml
Positive Control: Jurkat cell lysate |
|
|
