NXF5 Antibody - middle region (ARP41062_T100)

• Product Number: ARP41062_T100
• Name: NXF5 Antibody - middle region (ARP41062_T100)
• Protein Size (# AA): 397 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 55998
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Nuclear RNA export factor 5
• Peptide Sequence: Synthetic peptide located within the following region: ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Frints,S.G., (2003) Am. J. Med. Genet. A 119 (3), 367-374
• Description of Target: NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. Five transcript variants that encode different isoforms have been found for this gene.
• Protein Interactions: NXF1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NXF5 (ARP41062_T100) antibody is Catalog # AAP41062 (Previous Catalog # AAPY01121)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NXF5
• Uniprot ID: Q9H1B4
• Protein Name: Nuclear RNA export factor 5
• Protein Accession #: NP_116564
• Purification: Protein A purified
• Nucleotide Accession #: NM_032946
• Tested Species Reactivity: Human
• Gene Symbol: NXF5
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 86%
• Image 1: Human Jurkat
  
  WB Suggested Anti-NXF5 Antibody Titration: 2.5ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human HeLa
  
  Lanes:
  Lane 1: 7ug HeLa cystosolic extract
  Lane 2: 7ug HeLa nuclear extract
  Primary Antibody Dilution:
  1:100
  Secondary Antibody:
  Anti-rabbit-HRP
  Secondary Antibody Dilution:
  1:500
  Gene Name:
  NXF5
  Submitted by:
  Seiji Masuda, Kitashirakawa Oiwakecho, Kyoto University
  
• Image 3: Human Kidney
  
  Rabbit Anti-NXF5 Antibody
  Catalog Number: ARP41062
  Paraffin Embedded Tissue: Human Kidney
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 4: Human Intestine
  
  Rabbit Anti-NXF5 Antibody
  Catalog Number: ARP41062
  Paraffin Embedded Tissue: Human Intestine
  Cellular Data: Epithelial cells of intestinal villas
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X