NIFK Antibody - middle region (ARP41054_P050)

Data Sheet
 
Product Number ARP41054_P050
Product Page www.avivasysbio.com/nifk-antibody-middle-region-arp41054-p050.html
Name NIFK Antibody - middle region (ARP41054_P050)
Protein Size (# AA) 293 amino acids
Molecular Weight 32kDa
NCBI Gene Id 84365
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name nucleolar protein interacting with the FHA domain of MKI67
Alias Symbols Nopp34, MKI67IP
Peptide Sequence Synthetic peptide located within the following region: QPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li,H., (2004) J. Mol. Biol. 335 (1), 371-381
Description of Target This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19.
Protein Interactions TNIP1; SUMO3; UBC; LIN28B; SUMO1; ADARB1; EED; RNF2; CSNK2A2; Cbx5; Cbx3; Cbx1; CBX8; FTSJ3; NOP58; MED4; GNL3; RRS1; CDK19; RPL23; RPS24; RPS15A; RPS8; RPS6; RPS3; RPS2; RPL31; RPL30; RPL19; RPL18A; RPL18; RPL15; RPL11; RPL7; RPL5; RPL4; NOP2; NHP2L1; FB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NIFK (ARP41054_P050) antibody
Blocking Peptide For anti-NIFK (ARP41054_P050) antibody is Catalog # AAP41054 (Previous Catalog # AAPS02402)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MKI67IP
Uniprot ID Q9BYG3
Protein Name MKI67 FHA domain-interacting nucleolar phosphoprotein
Protein Accession # NP_115766
Purification Affinity Purified
Nucleotide Accession # NM_032390
Tested Species Reactivity Human
Gene Symbol NIFK
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 93%
Image 1
Human Thymus
WB Suggested Anti-MKI67IP Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Thymus
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com