Product Number |
ARP41054_P050 |
Product Page |
www.avivasysbio.com/nifk-antibody-middle-region-arp41054-p050.html |
Name |
NIFK Antibody - middle region (ARP41054_P050) |
Protein Size (# AA) |
293 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
84365 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
nucleolar protein interacting with the FHA domain of MKI67 |
Alias Symbols |
Nopp34, MKI67IP |
Peptide Sequence |
Synthetic peptide located within the following region: QPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Li,H., (2004) J. Mol. Biol. 335 (1), 371-381 |
Description of Target |
This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19. |
Protein Interactions |
TNIP1; SUMO3; UBC; LIN28B; SUMO1; ADARB1; EED; RNF2; CSNK2A2; Cbx5; Cbx3; Cbx1; CBX8; FTSJ3; NOP58; MED4; GNL3; RRS1; CDK19; RPL23; RPS24; RPS15A; RPS8; RPS6; RPS3; RPS2; RPL31; RPL30; RPL19; RPL18A; RPL18; RPL15; RPL11; RPL7; RPL5; RPL4; NOP2; NHP2L1; FB |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NIFK (ARP41054_P050) antibody |
Blocking Peptide |
For anti-NIFK (ARP41054_P050) antibody is Catalog # AAP41054 (Previous Catalog # AAPS02402) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MKI67IP |
Uniprot ID |
Q9BYG3 |
Protein Name |
MKI67 FHA domain-interacting nucleolar phosphoprotein |
Protein Accession # |
NP_115766 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_032390 |
Tested Species Reactivity |
Human |
Gene Symbol |
NIFK |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 93% |
Image 1 | Human Thymus
| WB Suggested Anti-MKI67IP Antibody Titration: 0.2-1 ug/ml Positive Control: Human Thymus |
|