Product Number |
ARP41019_P050 |
Product Page |
www.avivasysbio.com/bxdc5-antibody-n-terminal-region-arp41019-p050.html |
Name |
BXDC5 Antibody - N-terminal region (ARP41019_P050) |
Protein Size (# AA) |
349 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
80135 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ribosome production factor 1 homolog (S. cerevisiae) |
Alias Symbols |
BXDC5 |
Peptide Sequence |
Synthetic peptide located within the following region: AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Scherl,A., (2002) Mol. Biol. Cell 13 (11), 4100-4109 |
Description of Target |
BXDC5 may be required for ribosome biogenesis. |
Protein Interactions |
KRTAP10-7; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RPF1 (ARP41019_P050) antibody |
Blocking Peptide |
For anti-RPF1 (ARP41019_P050) antibody is Catalog # AAP41019 (Previous Catalog # AAPS02111) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BXDC5 |
Uniprot ID |
Q9H9Y2 |
Protein Name |
Ribosome production factor 1 |
Protein Accession # |
NP_079341 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_025065 |
Tested Species Reactivity |
Human |
Gene Symbol |
RPF1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79% |
Image 1 | Human K562
| WB Suggested Anti-BXDC5 Antibody Titration: 0.2-1 ug/ml Positive Control: K562 cell lysate |
| Image 2 | Human Breast
| Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0ug/ml using anti-BXDC5 antibody (ARP41019_P050) |
|
|