BXDC5 Antibody - N-terminal region (ARP41019_P050)

Data Sheet
 
Product Number ARP41019_P050
Product Page www.avivasysbio.com/bxdc5-antibody-n-terminal-region-arp41019-p050.html
Name BXDC5 Antibody - N-terminal region (ARP41019_P050)
Protein Size (# AA) 349 amino acids
Molecular Weight 38kDa
NCBI Gene Id 80135
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ribosome production factor 1 homolog (S. cerevisiae)
Alias Symbols BXDC5
Peptide Sequence Synthetic peptide located within the following region: AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Scherl,A., (2002) Mol. Biol. Cell 13 (11), 4100-4109
Description of Target BXDC5 may be required for ribosome biogenesis.
Protein Interactions KRTAP10-7; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RPF1 (ARP41019_P050) antibody
Blocking Peptide For anti-RPF1 (ARP41019_P050) antibody is Catalog # AAP41019 (Previous Catalog # AAPS02111)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BXDC5
Uniprot ID Q9H9Y2
Protein Name Ribosome production factor 1
Protein Accession # NP_079341
Purification Affinity Purified
Nucleotide Accession # NM_025065
Tested Species Reactivity Human
Gene Symbol RPF1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%
Image 1
Human K562
WB Suggested Anti-BXDC5 Antibody Titration: 0.2-1 ug/ml
Positive Control: K562 cell lysate
Image 2
Human Breast
Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0ug/ml using anti-BXDC5 antibody (ARP41019_P050)
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com