| Product Number |
ARP41015_T100 |
| Product Page |
www.avivasysbio.com/mrm1-antibody-c-terminal-region-arp41015-t100.html |
| Name |
MRM1 Antibody - C-terminal region (ARP41015_T100) |
| Protein Size (# AA) |
155 amino acids |
| Molecular Weight |
18kDa |
| NCBI Gene Id |
79922 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Mitochondrial rRNA methyltransferase 1 homolog (S. cerevisiae) |
| Peptide Sequence |
Synthetic peptide located within the following region: GTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L. (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
MRM1 belongs to the RNA methyltransferase trmH family and probably methylates the ribose of guanosine G-2270 in the peptidyl transferase center of the mitochondrial large ribosomal RNA (21S) |
| Protein Interactions |
AGTRAP; BMI1; EEF1A1; ICT1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MRM1 (ARP41015_T100) antibody |
| Blocking Peptide |
For anti-MRM1 (ARP41015_T100) antibody is Catalog # AAP41015 (Previous Catalog # AAPS02108) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human MRM1 |
| Uniprot ID |
Q6IN84-2 |
| Protein Name |
rRNA methyltransferase 1, mitochondrial |
| Protein Accession # |
AAH09416 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_024864 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MRM1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 91%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-MRM1 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
| Image 2 | Human Kidney
 | Rabbit Anti-MRM1 Antibody
Catalog Number: ARP41015
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
