NOC4L Antibody - C-terminal region (ARP41005_P050)

Data Sheet
 
Product Number ARP41005_P050
Product Page www.avivasysbio.com/noc4l-antibody-c-terminal-region-arp41005-p050.html
Name NOC4L Antibody - C-terminal region (ARP41005_P050)
Protein Size (# AA) 516 amino acids
Molecular Weight 57kDa
NCBI Gene Id 79050
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nucleolar complex associated 4 homolog (S. cerevisiae)
Alias Symbols NOC4, NET49, UTP19
Peptide Sequence Synthetic peptide located within the following region: CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Rual,J.F., (2005) Nature 437 (7062), 1173-1178
Description of Target NOC4L plays a specific role in biogenesis of 40 S subunit of ribosome.
Protein Interactions IKZF1; DNAJA3; BHLHE40; KRT15; CEP250; SIRT1; UBC; NOP58; PES1; POLR3C; ARL6IP5; ZNF148; RPL29; SIRT7; USHBP1; TSC22D4; NECAB2; PLSCR1; DAZAP2; PRSS23; SSSCA1; NT5C2; VIM;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NOC4L (ARP41005_P050) antibody
Blocking Peptide For anti-NOC4L (ARP41005_P050) antibody is Catalog # AAP41005 (Previous Catalog # AAPY01136)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NOC4L
Uniprot ID Q9BVI4
Protein Name Nucleolar complex protein 4 homolog
Protein Accession # NP_076983
Purification Affinity Purified
Nucleotide Accession # NM_024078
Tested Species Reactivity Human
Gene Symbol NOC4L
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 93%; Rat: 86%
Image 1
Human Jurkat
WB Suggested Anti-NOC4L Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Image 2
HUman Kidney
Rabbit Anti-NOC4L Antibody
Catalog Number: ARP41005
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com