PCBP4 Antibody - middle region (ARP40943_T100)

• Product Number: ARP40943_T100
• Name: PCBP4 Antibody - middle region (ARP40943_T100)
• Protein Size (# AA): 369 amino acids
• Molecular Weight: 41kDa
• NCBI Gene Id: 57060
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Poly(rC) binding protein 4
• Alias Symbols: CBP, LIP4, MCG10
• Peptide Sequence: Synthetic peptide located within the following region: SVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Chkheidze,A.N. (2003) Mol. Cell. Biol. 23 (23), 8405-8415
• Description of Target: PCBP4 is a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M.This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the encoded protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M. This gene's protein is found in the cytoplasm, yet it lacks the nuclear localization signals found in other subfamily members. Multiple alternatively spliced transcript variants have been described, but the full-length nature for only some has been determined.This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the encoded protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M. This gene's protein is found in the cytoplasm, yet it lacks the nuclear localization signals found in other subfamily members. Multiple alternatively spliced transcript variants have been described, but the full-length nature for only some has been determined.
• Protein Interactions: UBD; UBC; RBFOX1; RNF138; QKI; PCBP1; LYST;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PCBP4 (ARP40943_T100) antibody is Catalog # AAP40943 (Previous Catalog # AAPY01118)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCBP4
• Uniprot ID: Q9HCU2
• Protein Name: Poly(RC) binding protein 4, isoform CRA_d EMBL EAW65171.1
• Protein Accession #: NP_127502
• Purification: Protein A purified
• Nucleotide Accession #: NM_033009
• Tested Species Reactivity: Human
• Gene Symbol: PCBP4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%
• Image 1: Human Jurkat
  
  WB Suggested Anti-PCBP4 Antibody Titration: 1.25ug/ml
  Positive Control: Jurkat cell lysate